Somabiotech kirobiotech Jintropins HGH IGF-1 LR3 White Powder Injectable Real INSULIN-LIKE GROWTH FACTOR-1 LONG R3

Product name: IGF-1 LR3Specification: 1 mg/0.1mgAppearance: White powderForm & Formulations: Sterile Filtered white lyolized (freeze-dried)Purity: >98% by RP-HPLCWater Content: ≤ 7.0% by Karl FischerBacterial Endoc;‰¤ 5EU/mgSuitability: Suitable for culture and animal experiment, Not for human use! Storage: Lyolized powder although stable at room temperature for 1 months, it should be stored at -20°C(stable in 2 years), Avoid repeated freeze and thaw!Sequence: H-Met--Pro-Ala-Met-Pro-Leu-Ser-Ser-Leu--Val-Asn-Gly-Pro-Arg-Thr-Leu-Cys-Gly-Ala-Glu-Leu-Val-Asp-Ala-Leu-Gln--Val-Cys-Gly-Asp-Arg-Gly--Tyr--Asn-Lys-Pro-Thr-Gly-Tyr-Gly-Ser-Ser-Ser-Arg-Arg-Ala-Pro-Gln-Thr-Gly-Ile-Val-Asp-Glu-Cys-Cys--Arg-Ser-Cys-Asp-Leu-Glu-Met-Tyr-Cys-Ala-Pro-Leu-Lys-Pro-Ala-Lys-Ser-AlaCAS No.: 946870-92-4 One Letter Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSAMolar Mass: 9,111 Da Synonyms:Long r3 IGF-1, LR3 IGF, IGF1 LR3, Long Arg3 IGF-1Active chemical substance: IGF-1 long R3.Deliver:1 working day for ready goods,7 days to your destination.Pacakge:1kit=10vials   Alumnium foil+bubble+cartonCustomized:accepted.Country of Origin: ChinaWhat could us offer:1.Price: Competitive price from factory directly.2.Quality: The purity is above 98%, all products are produced in strict quality control standard. 3.Package: All products are packed in safe and stable parcels with aluminium foil bag, bubble wrap and paper box.4.Delivery: Secured,Fast and Guaranteed 100% delivery.Full stock ensures prompt delivery.Reship policy if the parcel withheld by your customs.5.Payment: Aliexpress, T/T, West union, Money gram. 6.MOQ: 1kit, Samples are availableRelated products:CJC-1295,GHRP-2/6,AOD-9604,HGH,HCG,IGF-1LR3,Ipamorelin, Melanotan II,Sermorelin,PT-14,TB-500,EPO, PEG MGF,MGF,GDF-8,ACE031,FST344,Selank.

hgh Description:Specification: 4iu, 6iu, 8iu, 10iu, 4mg, 16iu /customizedPackage: 10 Vials/KitStorage:2-8 degree centigrade refrigeratorProduct name: HGHPurity: above 98% Details:Human Growth hormone (GH or HGH), also known as somatotropin or , is a peptide hormone that stimulates growth, reproduction and regeneration in humans and other animals. It is a type of mitogen which is specific only to certain kinds of . Human Growth hormone is a 191-amino , single-chain polypeptide that is synthesized, stored, and secreted by somatotropic within the lateral wings of the anterior pituitary gland.HGH is a stress hormone that raises the concentration of glucose and free fatty . It also stimulates production of IGF-1.HGH is used as a prescription drug in medicine to treat children's growth disorders and adult growth hormone deficiency. What could us offer?1 Price: Competitive price from factory directly.2 Quality: The purity is very high, all products are produced in strict quality control standard. 3 Package: All products are packed in safe and stable parcels with aluminium foil bag, bubble wrap and paper box. 4 Delivery: Secured,Fast and Guaranteed deliver by HKEMS (DHL, TNT, FedEx, UPS). Full stock ensures prompt delivery and it takes about 4-7days to arrive your country. Tracking would be informed quickly after shipment.5 Payment: Paypal, Wester Union, TT.

What could us offer:

1. Price: Competitive price from factory directly.2. Quality: The purity is above 98%, all products are produced in strict quality control standard.3. Package: All products are packed in safe and stable parcels with aluminium foil bag, bubble wrap and paper box.4. Delivery:Warhouse in New York USA. Secured,Fast and Guaranteed 100% delivery.Full stock ensures prompt delivery.Reship policy if the parcel withheld by your customs.5. Payment: Aliexpress, T/T, West union, Money gram.6. MOQ: 1kit, Free Samples are available

7.Customize: accept customize for products top color and dosage

Related products: